{"product_id":"proteintech-31713-1-ap","title":"Proteintech, 31713-1-AP, SPTBN4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPTBN4 (31713-1-AP) by Proteintech is a Polyclonal antibody targeting SPTBN4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n31713-1-AP targets SPTBN4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPTBN4 also known as beta-IV spectrin, encodes a nonerythrocytic member of the beta-spectrin protein family that is expressed in the brain, peripheral nervous system, pancreas, and skeletal muscle. Spectrins are rod-shaped proteins that were originally identified as part of the lattice-like cytoskeleton under the erythrocyte membrane(PMID: 11086001).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36430 Product name: Recombinant human SPTBN4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2100-2300 aa of NM_020971 Sequence: WEERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPEIPGRVEPAALPAAPEDAAETPATPAAAEQVRPRPERQESADRAEELPRRRRPERQESVDQSEEAARRRRPERQESAEHEAAHSLTLGRYEQMERRRERRERRL Predict reactive species\nFull Name: spectrin, beta, non-erythrocytic 4\nCalculated Molecular Weight: 288kDa\nObserved Molecular Weight: 250, 140 kDa\nGenBank Accession Number: NM_020971\nGene Symbol: SPTBN4\nGene ID (NCBI): 57731\nRRID: AB_3670092\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H254\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887816003753,"sku":"31713-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31713-1-ap","provider":"Iright","version":"1.0","type":"link"}