{"product_id":"proteintech-31742-1-ap","title":"Proteintech, 31742-1-AP, KCNJ9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCNJ9 (31742-1-AP) by Proteintech is a Polyclonal antibody targeting KCNJ9 in WB, ELISA applications with reactivity to human, mouse, rat samples\n31742-1-AP targets KCNJ9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKCNJ9, also known as GIRK3 (G protein-activated inwardly rectifying potassium channel 3), is a crucial subunit that forms inwardly rectifying potassium channels. These channels are primarily activated by inhibitory G proteins (Gi\/o) downstream of various G protein-coupled receptors (GPCRs), such as those for neurotransmitters like GABA, acetylcholine, and adenosine. Upon activation, KCNJ9 facilitates potassium efflux, leading to membrane hyperpolarization and a reduction in neuronal excitability. It is widely expressed in the brain, where it plays a key role in regulating synaptic transmission and neuronal circuits, influencing processes ranging from pain perception to reward and motivation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35873 Product name: Recombinant human KCNJ9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 157-395 aa of BC167777 Sequence: MFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV Predict reactive species\nFull Name: potassium inwardly-rectifying channel, subfamily J, member 9\nObserved Molecular Weight: 38-44 kDa\nGenBank Accession Number: BC167777\nGene Symbol: KCNJ9\nGene ID (NCBI): 3765\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q92806\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887691419817,"sku":"31742-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31742-1-ap","provider":"Iright","version":"1.0","type":"link"}