{"product_id":"proteintech-31748-1-ap","title":"Proteintech, 31748-1-AP, C12orf30 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C12orf30 (31748-1-AP) by Proteintech is a Polyclonal antibody targeting C12orf30 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n31748-1-AP targets C12orf30 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  Calu-1 cells\nPositive IP detected in: mouse ovary tissue, HeLa cells\nPositive IHC detected in: human colon cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe C12orf30 gene encodes an auxiliary subunit of the N-terminal acetyltransferase B (NatB) complex, which is responsible for the acetylation of methionine residues at the N-terminus of proteins. The C12orf30 protein plays a role in the distribution and morphology of organelles, and is involved in cell migration and the dynamic changes of the cytoskeleton. In addition, polymorphisms in the C12orf30 gene are associated with susceptibility to various autoimmune diseases, such as rheumatoid arthritis, juvenile idiopathic arthritis, and type 1 diabetes. The C12orf30 protein also participates in regulating the function of immune cells, influencing their signal transduction.\nThe theoretical size of C12orf30 protein is 113 kDa, and it is possible that post-translational modifications may have shifted the protein band up to about 140 kD.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36383 Product name: Recombinant human C12orf30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 703-972 aa of BC113585 Sequence: LNHPVEPKNSEKTAENGVSSRIDILRLLLQQLEATLETGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLLEVKDGNLKTHPTLLENLVFFVETISVILWVSSYCESVLRPYKLNLQKKKKKKKETSIIMPPVFTSFQDYVTGLQTLISNVVDHIKGLETHLIALKLEELILEDTSLSPEERKFSKTVQGKVQSSYLHSLLEMGELLKKRLETTKKLKI Predict reactive species\nFull Name: chromosome 12 open reading frame 30\nObserved Molecular Weight: 113 kDa，140 kDa\nGenBank Accession Number: BC113585\nGene Symbol: C12orf30\nGene ID (NCBI): 80018\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q14CX7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885378293929,"sku":"31748-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31748-1-ap","provider":"Iright","version":"1.0","type":"link"}