{"product_id":"proteintech-31753-1-ap","title":"Proteintech, 31753-1-AP, HBG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HBG2 (31753-1-AP) by Proteintech is a Polyclonal antibody targeting HBG2 in WB, ELISA applications with reactivity to human samples\n31753-1-AP targets HBG2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, TF-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe gamma globin genes (HBG2, encoding Gγ-globin; HBG1 encoding Aγ-globin) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. Gamma chain production continues into adulthood in some beta-thalassemias and related conditions.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36028 Product name: Recombinant human HBG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC029387 Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLS Predict reactive species\nFull Name: hemoglobin, gamma G\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 14~16 kDa\nGenBank Accession Number: BC029387\nGene Symbol: HBG2\nGene ID (NCBI): 3048\nRRID: AB_3670105\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P69892\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887663763625,"sku":"31753-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31753-1-ap","provider":"Iright","version":"1.0","type":"link"}