{"product_id":"proteintech-31756-1-ap","title":"Proteintech, 31756-1-AP, ADGB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADGB (31756-1-AP) by Proteintech is a Polyclonal antibody targeting ADGB in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n31756-1-AP targets ADGB in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells\nPositive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADGB (Androglobin) is an evolutionarily conserved member of the globin protein family. It is specifically and highly expressed in spermatogenic cells (particularly sperm cells) of mammalian testes and in ciliated cells across various tissues. The ADGB protein possesses a unique structure, comprising a globin domain and a calmodulin-binding domain, suggesting its potential role in integrating gas (such as oxygen) sensing with calcium ion signaling functions.\nCurrent research indicates that ADGB plays a critical role in spermatogenesis within the male reproductive system, as well as in the formation and functional maintenance of cilia. Its functional deficiency may lead to abnormal sperm morphology and motility defects, thereby affecting male fertility. The target protein ADGB has a size of 235 kDa. This protein is unstable and prone to degradation, with degradation bands observed at 135 kDa, 70 kDa, and 55 kDa. (PMID: 36995441)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36246 Product name: Recombinant human C6orf103 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 550-700 aa of NM_024694 Sequence: ETATHSQTDLSQITKATSQGNTASQVILGKGTDEQTDFGLGDAHQSDGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCVCFQNIYIFHKPSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVRWGEYGAL Predict reactive species\nFull Name: chromosome 6 open reading frame 103\nCalculated Molecular Weight: 189kDa\nObserved Molecular Weight: 235 kDa\nGenBank Accession Number: NM_024694\nGene Symbol: C6orf103\nGene ID (NCBI): 79747\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N7X0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869803499689,"sku":"31756-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31756-1-ap","provider":"Iright","version":"1.0","type":"link"}