{"product_id":"proteintech-31795-1-ap","title":"Proteintech, 31795-1-AP, BRWD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BRWD3 (31795-1-AP) by Proteintech is a Polyclonal antibody targeting BRWD3 in WB, ELISA applications with reactivity to human samples\n31795-1-AP targets BRWD3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBromodomain and WD repeat-containing protein 3 (BRWD3) is thought to regulate gene expression through its interactions with chromatin. BRWD3 promotes the K48-linked polyubiquitination and degradation of KDM5, which depends on BRWD3 and Cul4. This function is critical for maintaining H3K4 methylation levels and regulating gene expression (PMID: 37722046). Mutations of BRWD3 are associated with a spectrum of cognitive disabilities and X-linked macrocephaly (PMID: 17668385).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36948 Product name: Recombinant human BRWD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1720-1802 aa of BC039508 Sequence: ATRAKRARIADDEFDTMFSGRFSRLPRIKTRNQGRRTVLYNDDSDNDNFVSTEDPLNLGTSRSGRVRKMTEKARVSHLMGWNY Predict reactive species\nFull Name: bromodomain and WD repeat domain containing 3\nCalculated Molecular Weight: 204 kDa\nObserved Molecular Weight: 240 kDa\nGenBank Accession Number: BC039508\nGene Symbol: BRWD3\nGene ID (NCBI): 254065\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6RI45\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885287035049,"sku":"31795-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31795-1-ap","provider":"Iright","version":"1.0","type":"link"}