{"product_id":"proteintech-31797-1-ap","title":"Proteintech, 31797-1-AP, TTC9C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TTC9C (31797-1-AP) by Proteintech is a Polyclonal antibody targeting TTC9C in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n31797-1-AP targets TTC9C in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, HeLa cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse testis tissue\nPositive IF\/ICC detected in: hTERT-RPE1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTTC9 family belongs to tetratricopeptide repeat (TPR)-containing proteins family (PMID: 35949301).The TPR motifs are arranged in antiparallel α-helical hairpins which are clustered to form flexible grooved interfaces. Members in TRP-containing proteins family are involved in a diverse range of biological functions, including cell cycle control, transcription, protein folding, and steroid receptor signaling (PMID: 15497498;PMID: 10786835).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37081 Product name: Recombinant human TTC9C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-171 aa of BC032123 Sequence: MEKRLQEAQLYKEEGNQRYREGKYRDAVSRYHRALLQLRGLDPSLPSPLPNLGPQGPALTPEQENILHTTQTDCYNNLAACLLQMEPVNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDQARHYLLAAVNRQPKDANVRRYLQLTQSELSSYHRKEKQLYLGMFG Predict reactive species\nFull Name: tetratricopeptide repeat domain 9C\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC032123\nGene Symbol: TTC9C\nGene ID (NCBI): 283237\nRRID: AB_3670117\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N5M4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887910736041,"sku":"31797-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31797-1-ap","provider":"Iright","version":"1.0","type":"link"}