{"product_id":"proteintech-31806-1-ap","title":"Proteintech, 31806-1-AP, CD23 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD23 (31806-1-AP) by Proteintech is a Polyclonal antibody targeting CD23 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n31806-1-AP targets CD23 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, RAW 264.7 cells\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD23 (low affinity IgE receptor) is a transmembrane glycoprotein of the C-type lectin family that is expressed mainly on a variety of immune cells including B cells, macrophages, and eosinophils. It plays a key role in the regulation of IgE production and B-cell differentiation by binding to IgE and promoting IgE-dependent antigen uptake and presentation to T cells. In addition, CD23 is involved in allergen processing, immune cell activation and antigen-specific immune responses. In clinical applications, CD23 is a potential target for the treatment of allergic diseases, and its inhibition reduces IgE-mediated inflammatory responses.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg1295 Product name: Recombinant Mouse CD23 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 51-331 aa of EDL21948.1 Sequence: TEKNLKQLGDTAIQNVSHVTKDLQKFQSNQLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLSQNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHINKKDSWIGLQDLNMEGEFVWSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLATCEISAPLASVTPTRPTPKSEP Predict reactive species\nFull Name: Fc receptor, IgE, low affinity II, alpha polypeptide\nCalculated Molecular Weight: 38kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: EDL21948.1\nGene Symbol: Fcer2a\nGene ID (NCBI): 14128\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P20693-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886150733993,"sku":"31806-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31806-1-ap","provider":"Iright","version":"1.0","type":"link"}