{"product_id":"proteintech-31835-1-ap","title":"Proteintech, 31835-1-AP, PLXNC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLXNC1 (31835-1-AP) by Proteintech is a Polyclonal antibody targeting PLXNC1 in IP, ELISA applications with reactivity to human, mouse samples\n31835-1-AP targets PLXNC1 in IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPlexin C1 (PLXNC1) located on chromosome 12 is a member of Plexin family composed of transmembrane proteins. PLXNC1 which was first described in the optic tectum participates in neuron cell adhesion and migration as a target receptor of Semaphorin 7A. In addition to the role in nervous system, there is considerable evidence in favor of the involvement of PLXNC1 in human diseases through regulating immunological response. For example, knockdown of PLXNC1 plays the suppressive role in hepatic ischemia-reperfusion injury and lung injury through reducing inflammatory response. Nevertheless, the effects of PLXNC1 on the biological processes of OA remain to be elaborated (PMID: 37853395). PLXNC1 has multiple glycosylation sites, which may cause the observed bands to migrate differently..\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36558 Product name: Recombinant human PLXNC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1208-1348 aa of BC156867 Sequence: IPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFTSDVEYSDDHCHLILPDSEAFQDVQGKRHRGKHKFKVKE Predict reactive species\nFull Name: plexin C1\nCalculated Molecular Weight: 1568 aa, 176 kDa\nObserved Molecular Weight: 150 kDa, 200 kDa\nGenBank Accession Number: BC156867\nGene Symbol: PLXNC1\nGene ID (NCBI): 10154\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O60486\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887766589609,"sku":"31835-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31835-1-ap","provider":"Iright","version":"1.0","type":"link"}