{"product_id":"proteintech-31844-1-ap","title":"Proteintech, 31844-1-AP, DNLZ Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNLZ (31844-1-AP) by Proteintech is a Polyclonal antibody targeting DNLZ in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n31844-1-AP targets DNLZ in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RT-4 cells\nPositive IHC detected in: mouse heart tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNL-type zinc finger (DNLZ, also known as HEP, ZIM17, TIMM15, and C9orf151) is a nuclear-encoded protein that is translocated to the mitochondria, thus it is located in mitochondrion and nucleoplasm (PMID: 22162012). It may function as a co-chaperone towards HSPA9\/mortalin, which enhances HSPA9 solubility and stimulates HSPA9 catalytic activity (PMID: 18632665; 20392697; 21530495).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37114 Product name: Recombinant human DNLZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC146915 Sequence: MLRTALRGAPRLLSRVQPRAPCLRRLWGRGARPEVAGRRRAWAWGWRRSSSEQGPGPAAALGRVEAAHYQLVYTCKVCGTRSSKRISKLAYHQGVVIVTCPGCQNHHIIADNLGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPEAGEDEGPPSPGKTEPS Predict reactive species\nFull Name: DNL-type zinc finger\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC146915\nGene Symbol: DNLZ\nGene ID (NCBI): 728489\nRRID: AB_3670126\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5SXM8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868835336361,"sku":"31844-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31844-1-ap","provider":"Iright","version":"1.0","type":"link"}