{"product_id":"proteintech-31906-1-ap","title":"Proteintech, 31906-1-AP, TRNT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRNT1 (31906-1-AP) by Proteintech is a Polyclonal antibody targeting TRNT1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n31906-1-AP targets TRNT1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  NIH\/3T3 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\ntRNA nucleotidyl transferase 1 (TRNT1, also known as CCA1, RPEM, SIFD, MtCCA, and CGI-47 ) is a cytosine-cytosine-adenine (CCA) - adding enzyme which belongs to the tRNA nucleotidyltransferase\/poly (A) polymerase family. It can catalyze the addition of the conserved nucleotide triplet CCA to the 3' terminus of tRNA molecules (PMID: 27370603). Mutations in TRNT1 would cause congenital sideroblastic anemia with immunodeficiency, fevers, and developmental delay (SIFD) (PMID: 25193871).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36149 Product name: Recombinant human TRNT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 271-405 aa of BC012537 Sequence: FKVQDDVTKLDLRLKIAKEEKNLGLFIVKNRKDLIKATDSSDPLKPYQDFIIDSREPDATTRVCELLKYQGEHCLLKEMQQWSIPPFPVSGHDIRKVGISSGKEIGALLQQLREQWKKSGYQMEKDELLSYIKKT Predict reactive species\nFull Name: tRNA nucleotidyl transferase, CCA-adding, 1\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC012537\nGene Symbol: TRNT1\nGene ID (NCBI): 51095\nRRID: AB_3670139\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96Q11\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887840022697,"sku":"31906-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31906-1-ap","provider":"Iright","version":"1.0","type":"link"}