{"product_id":"proteintech-31907-1-ap","title":"Proteintech, 31907-1-AP, PABPC1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PABPC1L (31907-1-AP) by Proteintech is a Polyclonal antibody targeting PABPC1L in WB, ELISA applications with reactivity to human, mouse, rat samples\n31907-1-AP targets PABPC1L in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, mouse kidney tissue,  mouse liver tissue,  rat liver tissue,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPAP1L, also known as PABPC1L, is a human gene that has been associated with various cellular processes, particularly in the context of reproduction and embryonic development. PABPC1L was markedly upregulated in RCC, and high PABPC1L expression correlated with unfavorable prognosis and resistance to ICB (PMID: 38382068).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36248 Product name: Recombinant human PABPC1L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 350-530 aa of NM_001124756 Sequence: RLSTMRTLSNPLLGSFQQPSSYFLPAMPQPPAQAAYYGCGPVTPTQPAPRWTSQPPRPSCASMVRPPVVPRRPPAHISSVRQASTQVPRTVPHTQRVANIGTQTTGPSGVGCCTPGRPLLPCKCSSAAHSTYRVQEPAVHIPGQEP Predict reactive species\nFull Name: poly(A) binding protein, cytoplasmic 1-like\nCalculated Molecular Weight: 68 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_001124756\nGene Symbol: PABPC1L\nGene ID (NCBI): 80336\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887749255337,"sku":"31907-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31907-1-ap","provider":"Iright","version":"1.0","type":"link"}