{"product_id":"proteintech-31909-1-ap","title":"Proteintech, 31909-1-AP, CD20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD20 (31909-1-AP) by Proteintech is a Polyclonal antibody targeting CD20 in WB, IHC, IF-P, ELISA applications with reactivity to mouse, rat samples\n31909-1-AP targets CD20 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, rat spleen tissue\nPositive IHC detected in: mouse spleen tissue, rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse spleen tissue, mouse colon tissue,  rat spleen tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD20 is a 33-37 kDa transmembrane phosphoprotein. CD20 is a B-lymphocyte surface molecule that is widely expressed during B-cell ontogeny, from early pre-B-cell developmental stages until final differentiation into plasma cells. CD20 functions as a calcium-permeable cation channel. It is involved in the regulation of B-cell activation and proliferation. CD20 serves as a useful target for antibody-mediated therapeutic depletion of B-cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36918 Product name: Recombinant mouse Ms4a1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 204-291 aa of NM_007641 Sequence: GIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP* Predict reactive species\nFull Name: membrane-spanning 4-domains, subfamily A, member 1\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: NM_007641\nGene Symbol: Ms4a1\nGene ID (NCBI): 12482\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P19437\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869652603049,"sku":"31909-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31909-1-ap","provider":"Iright","version":"1.0","type":"link"}