{"product_id":"proteintech-31914-1-ap","title":"Proteintech, 31914-1-AP, FAM222A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM222A (31914-1-AP) by Proteintech is a Polyclonal antibody targeting FAM222A in WB, ELISA applications with reactivity to human samples\n31914-1-AP targets FAM222A in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HepG2 cells,  HuH-7 cells,  MDA-MB-453 cells,  SH-SY5Y cells,  TT cells,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFamily with sequence similarity 222 member A (FAM222A, also known as C12orf34) is associated with the progress of Alzheimer's disease (PMID: 31964863; 37092222). It is also a novel key determinant of endothelial biology and angiogenesis (PMID: 37942611).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36045 Product name: Recombinant human C12orf34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 191-325 aa of BC037221 Sequence: LPPSNLPSIHSLLYQLNQQCQAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYADSGLDYLLWPQKPPPPPPQPLRAYSGSTVASKSPEACGGRAYERAS Predict reactive species\nFull Name: chromosome 12 open reading frame 34\nCalculated Molecular Weight: 47 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC037221\nGene Symbol: C12orf34\nGene ID (NCBI): 84915\nRRID: AB_3670141\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5U5X8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868842971305,"sku":"31914-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31914-1-ap","provider":"Iright","version":"1.0","type":"link"}