{"product_id":"proteintech-31922-1-ap","title":"Proteintech, 31922-1-AP, CCDC167 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCDC167 (31922-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC167 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n31922-1-AP targets CCDC167 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  HuH-7 cells,  LNCaP cells,  Raji cells,  Ramos cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCoiled-coil domain (CCD) constituents are alpha-helix motifs expressed in different types of proteins, which can function in various biological processes, including cell proliferation, migration, and signal transduction (PMID: 9171830; 17428801). The coiled-coil domain containing 167 (CCDC167, also known as HSPC265 and C6orf129) is a membrane protein highly expressed in the lymph node. It is associated with immune function, which could be a therapeutic target for breast cancer and asthma (PMID: 33461170; 31821602).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37080 Product name: Recombinant human C6orf129 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of BC108655 Sequence: MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFLRQENRKN Predict reactive species\nFull Name: chromosome 6 open reading frame 129\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC108655\nGene Symbol: C6orf129\nGene ID (NCBI): 154467\nRRID: AB_3670146\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9P0B6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868842774697,"sku":"31922-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31922-1-ap","provider":"Iright","version":"1.0","type":"link"}