{"product_id":"proteintech-31931-1-ap","title":"Proteintech, 31931-1-AP, SPINT3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPINT3 (31931-1-AP) by Proteintech is a Polyclonal antibody targeting SPINT3 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n31931-1-AP targets SPINT3 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse testis tissue,  A549 cells,  mouse epididymis tissue,  rat testis tissue\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSerine peptidase inhibitor, Kunitz type 3 (SPINT3, also known as HKIB9) might be related to serine-type endopeptidase inhibitor activity, receptor antagonist activity, and transforming growth factor beta binding (PMID: 21988899). The calculated molecular weight of SPINT3 is 10 kDa, which is lower than its observed molecular weight of 30-35 kDa by SDS-PAGE detection (PMID: 21988899).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35289 Product name: Recombinant human SPINT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-89 aa of NM_006652.1 Sequence: RDTIKDLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFCKFT Predict reactive species\nFull Name: serine peptidase inhibitor, Kunitz type, 3\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: NM_006652.1\nGene Symbol: SPINT3\nGene ID (NCBI): 10816\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P49223\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887815053481,"sku":"31931-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31931-1-ap","provider":"Iright","version":"1.0","type":"link"}