{"product_id":"proteintech-31969-1-ap","title":"Proteintech, 31969-1-AP, NOP16 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NOP16 (31969-1-AP) by Proteintech is a Polyclonal antibody targeting NOP16 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n31969-1-AP targets NOP16 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, Hela cells,  K-562 cells,  MCF-7 cells,  Raji cells\nPositive IF\/ICC detected in: A431 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNOP16, also known as HSPC111, is found in the intracellular protein complex. It is a ribosomal protein that is transcriptionally regulated by the oncogene c-Myc. NOP16 may be involved in the completion of ribosome synthesis, therefore, reduced NOP16 expression in cancer cells may block many biological processes. Studies indicate that NOP16 is highly expressed in more than 20 types of cancers, including colorectal, breast, and hepatocellular carcinoma, and is an important target for clinical treatment of related diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36714 Product name: Recombinant human NOP16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC040106 Sequence: MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE Predict reactive species\nFull Name: NOP16 nucleolar protein homolog (yeast)\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC040106\nGene Symbol: NOP16\nGene ID (NCBI): 51491\nRRID: AB_3670160\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9Y3C1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887740276905,"sku":"31969-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31969-1-ap","provider":"Iright","version":"1.0","type":"link"}