{"product_id":"proteintech-31970-1-ap","title":"Proteintech, 31970-1-AP, KBTBD8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KBTBD8 (31970-1-AP) by Proteintech is a Polyclonal antibody targeting KBTBD8 in WB, ELISA applications with reactivity to human samples\n31970-1-AP targets KBTBD8 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, RKO cells,  U-118 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKelch repeat and BTB domain containing 8 (KBTBD8, also known as TAKRP and TA-KRP) is a member of the BTB-kelch family of proteins, which is specifically localized at the Golgi apparatus in nondividing cells and becomes restricted to the spindle apparatus upon mitosis (PMID: 23578279). KBTBD family proteins are involved in ubiquitination in various cells and tissues and are correlated with human muscle diseases (PMID: 9878064; 16547521; 24959344). The expression level of KBTBD8 might affect the proliferation and migration of epithelial ovarian cancer (PMID: 33109073).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36219 Product name: Recombinant human KBTBD8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-420 aa of NM_032505.2 Sequence: QELGDRSKEYIRKKFLCVTKEQEFLQLTKDQLISILDSDDLNVDREEHVYESIIRWFEHEQNEREVHLPEIFAKCIRFPLMEDTFIEKIPPQFAQAIAKSCVEKGPSNTNGCTQRLGMTASEMIICFDAAHKHSGKKQTVPCLDIVTGRVFKLCKPPNDLREVGILVSPDNDIYIAGGYRPSSSEVSIDHKAENDFWMYDHSTNRWLSKPSLLRARIGCKLVYCCGKMYAIGGRVYEGDGRNSLKSVECYDSRENC Predict reactive species\nFull Name: kelch repeat and BTB (POZ) domain containing 8\nCalculated Molecular Weight: 69 kDa，601aa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: NM_032505.2\nGene Symbol: KBTBD8\nGene ID (NCBI): 84541\nRRID: AB_3670161\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8NFY9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868843167913,"sku":"31970-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31970-1-ap","provider":"Iright","version":"1.0","type":"link"}