{"product_id":"proteintech-31972-1-ap","title":"Proteintech, 31972-1-AP, ZNF618 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF618 (31972-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF618 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n31972-1-AP targets ZNF618 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, SH-SY5Y cells,  Caki-2 cells\nPositive IHC detected in: human cervical cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZinc finger protein 618 (ZNF618) is a key protein associated with DNA methylation and acts as a specific 5hmC reader in vivo to regulate UHRF2 function by promoting UHRF2 chromatin localization. In addition, ZNF618 is not only associated with the induction, maintenance or progression of female breast cancer, but is also up-regulated in lung cancer cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36487 Product name: Recombinant human ZNF618 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 200-382 aa of NM_001318042.1 Sequence: YSCFQEHRDLHAVDVFSVEGAPENRADPFDQGVVATDEVKEEPPEPFQKIGPKTGNYTCEFCGKQYKYYTPYQEHVALHAPISTAPGWEPPDDPDTGSECSHPEVSPSPRFVAAKTQTNQSGKKAPASVVRCATLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETN Predict reactive species\nFull Name: zinc finger protein 618\nCalculated Molecular Weight: 105kDa，954aa\nObserved Molecular Weight: 100-113 kDa\nGenBank Accession Number: NM_001318042.1\nGene Symbol: ZNF618\nGene ID (NCBI): 114991\nRRID: AB_3670163\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5T7W0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887951204521,"sku":"31972-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31972-1-ap","provider":"Iright","version":"1.0","type":"link"}