{"product_id":"proteintech-31989-1-ap","title":"Proteintech, 31989-1-AP, ANP32E Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANP32E (31989-1-AP) by Proteintech is a Polyclonal antibody targeting ANP32E in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n31989-1-AP targets ANP32E in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, DU 145 cells,  HeLa cells,  K-562 cells,  MCF-7 cells\nPositive IHC detected in: mouse kidney tissue, human lung tissue,  mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse small intestine tissue\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAcidic nuclear phosphoprotein 32 family member E (ANP32E) is a histone chaperone that removes H2A.Z from chromatin. ANP32E is implicated in many cellular processes, including chromatin modification and remodeling, gene regulation, protein phosphorylation, and regulation of intracellular trafficking, and contributes to early development and cancer metastasis in mammals. In addition, ANP32E is involved in tumor development and is highly expressed in pancreatic and thyroid cancer cells, and promotes tumorigenesis in gastric cancer (GC) cells by inducing NUF2 expression.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33772 Product name: Recombinant human ANP32E protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 159-268 aa of BC003380 Sequence: EEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQDEEDDDDYVEEGEEEEEEEEGGLRGEKRKRDAEDDGEEEDD* Predict reactive species\nFull Name: acidic (leucine-rich) nuclear phosphoprotein 32 family, member E\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC003380\nGene Symbol: ANP32E\nGene ID (NCBI): 81611\nRRID: AB_3670167\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9BTT0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884971020457,"sku":"31989-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-31989-1-ap","provider":"Iright","version":"1.0","type":"link"}