{"product_id":"proteintech-32030-1-ap","title":"Proteintech, 32030-1-AP, TCF20 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TCF20 (32030-1-AP) by Proteintech is a Polyclonal antibody targeting TCF20 in WB, ELISA applications with reactivity to human samples\n32030-1-AP targets TCF20 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, U-251 cells,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTranscription Factor 20 (TCF20) is a transcriptional activator that binds to the regulatory region of MMP3 and thereby controls stromelysin expression. It stimulates the activity of various transcriptional activators such as JUN, SP1, PAX6 and ETS1, suggesting a function as a coactivator (PMID: 10995766). The calculated molecular weight of TCF20 is 211 kDa, but due to extensive modifications (Glycosylation, Sumoylation. Phosphorylation), the observed molecular weight is about 250 kda.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36912 Product name: Recombinant human TCF20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 480-650 aa of NM_005650 Sequence: TPQKKTSKRPSSSKKADSCTNSEGSSQPEEQLKSPMAESLDGGCSSSSEDQGERVRQLSGQSTSSDTTYKGGASEKAGSSPAQGAQNEPPRLNASPAAREEATSPGAKDMPLSSDGNPKVNEKTVGVIVSREAMTGRVEKPGGQDKGSQEDDPAATQRPPSNGGAKETSHA Predict reactive species\nFull Name: transcription factor 20 (AR1)\nCalculated Molecular Weight: 1960aa, 212 kDa\nObserved Molecular Weight: 250 kDa\nGenBank Accession Number: NM_005650\nGene Symbol: TCF20\nGene ID (NCBI): 6942\nRRID: AB_3670174\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UGU0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887824851113,"sku":"32030-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32030-1-ap","provider":"Iright","version":"1.0","type":"link"}