{"product_id":"proteintech-32038-1-ap","title":"Proteintech, 32038-1-AP, AMN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AMN (32038-1-AP) by Proteintech is a Polyclonal antibody targeting AMN in WB, IF\/ICC, ELISA applications with reactivity to human samples\n32038-1-AP targets AMN in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuH-7 cells, Jurkat cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAmnion associated transmembrane protein (AMN, also known as IGS2, PRO1028, and amnionless) is a 45-50 kDa cysteine-rich type I transmembrane protein that is expressed exclusively in the extra-embryonic visceral endoderm layer during gastrulation (PMID: 17990981; 11279523). It may direct the production of trunk mesoderm derived from the middle streak by acting in the underlying visceral endoderm to modulate a BMP signaling pathway (PMID: 11279523).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35205 Product name: Recombinant human AMN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-204 aa of NM_030943.3 Sequence: VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRSGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISALGRTFTRDEDLAVFLASRAGRLRFHGPGALSVGPED Predict reactive species\nFull Name: amnionless homolog (mouse)\nCalculated Molecular Weight: 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: NM_030943.3\nGene Symbol: AMN\nGene ID (NCBI): 81693\nRRID: AB_3670177\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9BXJ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869809266857,"sku":"32038-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32038-1-ap","provider":"Iright","version":"1.0","type":"link"}