{"product_id":"proteintech-32079-1-ap","title":"Proteintech, 32079-1-AP, ESM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ESM1 (32079-1-AP) by Proteintech is a Polyclonal antibody targeting ESM1 in WB, ELISA applications with reactivity to human samples\n32079-1-AP targets ESM1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nESM1, also known as endothelial cell-specific molecule 1 or endocan, is a protein-coding gene that encodes a secreted protein. It is primarily expressed in endothelial cells of human lung and kidney tissues, and its expression is regulated by cytokines, suggesting a role in endothelium-dependent pathological disorders. ESM1 has been implicated in various diseases, including gastric cancer, hypertension, and cervical cancer. In cervical cancer, ESM1 is overexpressed and acts as an independent prognostic factor associated with poor clinical outcomes. It promotes carcinoma angiogenesis and cervical squamous cell carcinoma progression through the VEGF\/ERK signaling pathway.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36144 Product name: Recombinant human ESM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-184 aa of BC011989 Sequence: KDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR Predict reactive species\nFull Name: endothelial cell-specific molecule 1\nCalculated Molecular Weight: 184 aa, 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC011989\nGene Symbol: ESM1\nGene ID (NCBI): 11082\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NQ30\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887627980969,"sku":"32079-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32079-1-ap","provider":"Iright","version":"1.0","type":"link"}