{"product_id":"proteintech-32088-1-ap","title":"Proteintech, 32088-1-AP, PIANP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PIANP (32088-1-AP) by Proteintech is a Polyclonal antibody targeting PIANP in WB, ELISA applications with reactivity to human samples\n32088-1-AP targets PIANP in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPianp (also known as Leda-1) is a type I transmembrane protein with preferential expression in the mammalian CNS.  Its processing is characterized by proteolytic cleavage by a range of proteases including Adam10, Adam17, MMPs, and the γ-secretase complex.  Pianp can interact with Pilrα and the GB1a subunit of the GABAB receptor (GBR) complex. Pianp represents a novel candidate gene involved in autism-like behavior, cerebellar and hippocampal pathology, and GBR signaling (PMID: 31511635).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35273 Product name: Recombinant human C12orf53 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-178 aa of BC035736 Sequence: SSSSPRTPPAPARPPCARGGPSAPRHVCVWERAPPPSRSPRVPRSRRQVLPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLILGEAPATLRPFLFGGRGEGVDP Predict reactive species\nFull Name: chromosome 12 open reading frame 53\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC035736\nGene Symbol: C12orf53\nGene ID (NCBI): 196500\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8IYJ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887762198697,"sku":"32088-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32088-1-ap","provider":"Iright","version":"1.0","type":"link"}