{"product_id":"proteintech-32098-1-ap","title":"Proteintech, 32098-1-AP, SEC14L3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEC14L3 (32098-1-AP) by Proteintech is a Polyclonal antibody targeting SEC14L3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n32098-1-AP targets SEC14L3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, mouse lung tissue,  rat lung tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEC14L3 is highly similar to the protein encoded by the Saccharomyces cerevisiae SEC14 gene. The SEC14 protein is a phophatidylinositol transfer protein that is essential for biogenesis of Golgi-derived transport vesicles, and thus is required for the export of yeast secretory proteins from the Golgi complex. The specific function of this protein has not yet been determined. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36792 Product name: Recombinant human SEC14L3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-182 aa of BC069641 Sequence: GLLFSVTKQDLLKTKMRDCERILHECDLQTERLGKKIETIVMIFDCEGLGLKHFWKPLVEVYQEFFGLLEENY Predict reactive species\nFull Name: SEC14-like 3 (S. cerevisiae)\nCalculated Molecular Weight: 46 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC069641\nGene Symbol: SEC14L3\nGene ID (NCBI): 266629\nRRID: AB_3670189\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UDX4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887795294377,"sku":"32098-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32098-1-ap","provider":"Iright","version":"1.0","type":"link"}