{"product_id":"proteintech-32101-1-ap","title":"Proteintech, 32101-1-AP, RWDD4A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RWDD4A (32101-1-AP) by Proteintech is a Polyclonal antibody targeting RWDD4A in WB, ELISA applications with reactivity to human samples\n32101-1-AP targets RWDD4A in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: 5637 cells, SH-SY5Y cells,  U-251 cells,  U-87MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRWDD4, which is a poorly characterized gene that encodes the protein RWD Domain Containing 4, with an RWD domain being involved in protein-protein interactions (PMID: 27916600). RWDD4 was revealed to be a miR506 target in BCa cells, and the downregulation of RWDD4 was found to suppress BCa cell proliferation, migration and invasion (PMID: 30655740).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36777 Product name: Recombinant human RWDD4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-188 aa of BC107432 Sequence: MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAMTYTLFEYAKDNKEQFMENHNPINSATSISNIISIETPNTAPSSKKKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDDE Predict reactive species\nFull Name: RWD domain containing 4A\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21 kDa\nGenBank Accession Number: BC107432\nGene Symbol: RWDD4A\nGene ID (NCBI): 201965\nRRID: AB_3670191\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6NW29\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887791067305,"sku":"32101-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32101-1-ap","provider":"Iright","version":"1.0","type":"link"}