{"product_id":"proteintech-32151-1-ap","title":"Proteintech, 32151-1-AP, CD63 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD63 (32151-1-AP) by Proteintech is a Polyclonal antibody targeting CD63 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n32151-1-AP targets CD63 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HUVEC cells,  HeLa cells,  K-562 cells\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD63, also known as LIMP, LAMP-3, gp55, and melanoma-associated antigen (ME491), is a member of the four-times transmembrane protein superfamily (TM4SF), which constitutes a major component of lysosomal membranes. CD63 is used as a marker for exocytosis, is involved in cellular protein sorting of late endosomes and multivesicular bodies, facilitates exosome formation, and plays a role in activating ITGB1 and integrin signaling. Furthermore, CD63 is involved in intercellular adhesion through interactions with other cell surface molecules.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2110 Product name: Recombinant Mouse CD63 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 103-203 aa of NM_001042580.1 Sequence: AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI Predict reactive species\nFull Name: CD63 antigen\nCalculated Molecular Weight: 26kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: NM_001042580.1\nGene Symbol: Cd63\nGene ID (NCBI): 12512\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P41731\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869398749353,"sku":"32151-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32151-1-ap","provider":"Iright","version":"1.0","type":"link"}