{"product_id":"proteintech-32161-1-ap","title":"Proteintech, 32161-1-AP, UBFD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBFD1 (32161-1-AP) by Proteintech is a Polyclonal antibody targeting UBFD1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n32161-1-AP targets UBFD1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  Jurkat cells,  NIH\/3T3 cells\nPositive IF\/ICC detected in: ROS1728 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBFD1 (Ubiquitin Family Domain Containing 1) is a polyubiquitin-binding protein containing ubiquitin-like structural domains that are widely involved in protein degradation and cell signaling. This protein shows aberrant expression in a variety of cancers, especially in estrogen receptor (ER)-positive breast cancer, where high expression of UBFD1 is closely associated with poor prognosis of patients, and is considered as a potential prognostic biomarker and therapeutic target. In addition, UBFD1 was also found to be associated with MYC-mediated tumor aggressiveness in T-cell acute lymphoblastic leukemia (T-ALL), which functionally involves the endoplasmic reticulum-associated degradation (ERAD) pathway. UBFD1 is also expressed in inner ear hair cells and ear epithelial cells, suggesting that it may play a role in hearing-related diseases.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36361 Product name: Recombinant human UBFD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-270 aa of NM_019116 Sequence: MAAAGAPDGMEEPGMDTEAETVATEAPARPVNCLEAEAAAGAAAEDSGAARGSLQPAPAQPPGDPAAQASVSNGEDAGGGAGRELVDLKIIWNKTKHDVKFPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLREIKVTSGAKIMVVGSTINDVLAVNTPKDAAQQDAKAEENKKEPLCRQKQHRKVLDKGKPEDVMPSVKGAQERLPTVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGHEDY Predict reactive species\nFull Name: ubiquitin family domain containing 1\nCalculated Molecular Weight: 309aa, 33 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: NM_019116\nGene Symbol: UBFD1\nGene ID (NCBI): 56061\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O14562\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887913685161,"sku":"32161-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32161-1-ap","provider":"Iright","version":"1.0","type":"link"}