{"product_id":"proteintech-32179-1-ap","title":"Proteintech, 32179-1-AP, TOM1L2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOM1L2 (32179-1-AP) by Proteintech is a Polyclonal antibody targeting TOM1L2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n32179-1-AP targets TOM1L2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, A-253 cells,  BxPC-3 cells,  HaCaT cells,  LNCaP cells,  U-251 cells,  NIH\/3T3 cells,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTarget of Myb-like protein 2 (TOM1L2) acts as a MYO6\/Myosin VI adapter protein that targets myosin VI to endocytic structures (PMID: 23023224). It may play a role in recruiting clathrin to endosomes and regulating growth factor-induced mitogenic signaling (PMID: 16412388; 16479011). TOM1L2 also regulates membrane trafficking that is linked to immunity and cell proliferation (PMID: 20604899).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37612 Product name: Recombinant human TOM1L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 300-457 aa of NM_001082968.1 Sequence: LRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTS Predict reactive species\nFull Name: target of myb1-like 2 (chicken)\nCalculated Molecular Weight: 56 kDa，507aa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: NM_001082968.1\nGene Symbol: TOM1L2\nGene ID (NCBI): 146691\nRRID: AB_3670215\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6ZVM7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868838908073,"sku":"32179-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32179-1-ap","provider":"Iright","version":"1.0","type":"link"}