{"product_id":"proteintech-32207-1-ap","title":"Proteintech, 32207-1-AP, ABL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ABL1 (32207-1-AP) by Proteintech is a Polyclonal antibody targeting ABL1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n32207-1-AP targets ABL1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HEK-293 cells,  HeLa cells,  Jurkat cells,  LNCaP cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nABL1, also named as ABL, JTK7, c-ABL and p150, belongs to the protein kinase superfamily, Tyr protein kinase family and ABL subfamily. ABL1 regulates cytoskeleton remodeling during cell differentiation, cell division and cell adhesion. ABL1 localizes to dynamic actin structures, and phosphorylates CRK and CRKL, DOK1, and other proteins controlling cytoskeleton dynamics. It regulates DNA repair potentially by activating the proapoptotic pathway when the DNA damage is too severe to be repaired. ABL1 catalyze the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate. A chromosomal aberration involving ABL1 is a cause of chronic myeloid leukemia (CML) [MIM:608232]. Translocation t(9;22)(q34;q11) with BCR. The translocation produces a BCR-ABL found also in acute myeloid leukemia (AML) and acute lymphoblastic leukemia (ALL).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag26145 Product name: Recombinant human ABL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 801-900 aa of NM_005157 Sequence: MIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGSALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP Predict reactive species\nFull Name: c-abl oncogene 1, receptor tyrosine kinase\nCalculated Molecular Weight: 123 kDa\nObserved Molecular Weight: 120-130 kDa\nGenBank Accession Number: NM_005157\nGene Symbol: ABL1\nGene ID (NCBI): 25\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P00519\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869799043241,"sku":"32207-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32207-1-ap","provider":"Iright","version":"1.0","type":"link"}