{"product_id":"proteintech-32225-1-ap","title":"Proteintech, 32225-1-AP, SEC24B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SEC24B (32225-1-AP) by Proteintech is a Polyclonal antibody targeting SEC24B in WB, ELISA applications with reactivity to human samples\n32225-1-AP targets SEC24B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSEC24B is a gene that encodes a protein belonging to the SEC23\/SEC24 family, which is involved in vesicle trafficking. The protein is thought to be a cargo-binding component of the COPII vesicle and is involved in the transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36544 Product name: Recombinant human SEC24B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-250 aa of NM_006323.4 Sequence: QNVTPNTVNQQPGAQQLYSRGPPAPHIVGSTLGSFQGAASSASHLHTSASQPYSSFVNHYNSPAMYSASSSVASQGFPSTCGHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQNAPTVRPVKDNSFSGQNTAISHPSPLPPLPSQQHHQ Predict reactive species\nFull Name: SEC24 family, member B (S. cerevisiae)\nCalculated Molecular Weight: 137kDa，1268aa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: NM_006323.4\nGene Symbol: SEC24B\nGene ID (NCBI): 10427\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O95487\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887795818665,"sku":"32225-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32225-1-ap","provider":"Iright","version":"1.0","type":"link"}