{"product_id":"proteintech-32245-1-ap","title":"Proteintech, 32245-1-AP, IL-1 beta Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-1 beta (32245-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1 beta in WB, ELISA applications with reactivity to human samples\n32245-1-AP targets IL-1 beta in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37117 Product name: Recombinant human IL1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-170 aa of BC008678 Sequence: AMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESND Predict reactive species\nFull Name: interleukin 1, beta\nCalculated Molecular Weight: 269 aa, 31 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC008678\nGene Symbol: IL1B\nGene ID (NCBI): 3553\nENSEMBL Gene ID: ENSG00000125538\nRRID: AB_3670228\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P01584\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887678640297,"sku":"32245-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32245-1-ap","provider":"Iright","version":"1.0","type":"link"}