{"product_id":"proteintech-32248-1-ap","title":"Proteintech, 32248-1-AP, SORCS3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SORCS3 (32248-1-AP) by Proteintech is a Polyclonal antibody targeting SORCS3 in WB, ELISA applications with reactivity to human, mouse, rat samples\n32248-1-AP targets SORCS3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-N-SH cells, IMR-32 cells. SH-SY5Y cells,  mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSortilin related VPS10 domain-containing receptor 3 (SorCS3) belongs to the vacuolar protein sorting 10 protein (VPS10p) receptor family. SorCS3 is a specific receptor for nerve growth factor (NGF) that regulates NGF signal transduction across membranes, and SorCS3 is mainly expressed in the hippocampus and cortex of the brain (PMID: 35393432).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37710 Product name: Recombinant human SORCS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-190 aa of NM_014978.2 Sequence: EITWDATGGPGRPAAPASRPPALSPLSPRAVASQWPEELASARRAAVLGRRAGPELLPQQGGGRGGEMQVEAGGTSPAGERRGRGIPAPAKLGGARRSRRAQPPITQERGDAWATAPADGSRGSRPLAKGSREEVKAPRAGGSAAEDLRLPSTSFAL Predict reactive species\nFull Name: sortilin-related VPS10 domain containing receptor 3\nCalculated Molecular Weight: 136kDa，1222aa\nObserved Molecular Weight: 160 kDa\nGenBank Accession Number: NM_014978.2\nGene Symbol: SORCS3\nGene ID (NCBI): 22986\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UPU3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887812366505,"sku":"32248-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32248-1-ap","provider":"Iright","version":"1.0","type":"link"}