{"product_id":"proteintech-32274-1-ap","title":"Proteintech, 32274-1-AP, ZNF706 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF706 (32274-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF706 in WB, ELISA applications with reactivity to human samples\n32274-1-AP targets ZNF706 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HepG2 cells,  SMMC-7221 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZinc Finger domains account for 5% of all human proteins and interact with various substrates, such as lipids, DNA, RNA, and post-translational modifications. In addition, zinc finger proteins (ZNFs) are involved in transcriptional regulation, signal transduction, and other cellular processes. Zinc finger protein 706 (ZNF706), encoded by a gene located at chromosome 8q22.3, is a member of the C2H2-type zinc finger transcription factor family, the most abundant transcription factor family encoded by the human genome.   And according to the structural analysis of ZNF706, it was definitely predicted to physically bind to DNA through the C-terminal zinc finger domain. In previous studies, it was reported that the expression of ZNF706 is upregulated in gastric cancer and laryngeal cancer. And ZNF706 may be a biomarker for the early diagnosis of rheumatoid arthritis. ZNF706 is a potential oncogene in liver cancer and functions as a ferroptosis regulator by modulating SLC7A11 expression, constituting a potential therapeutic target for HCC (PMID: 38862581).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37605 Product name: Recombinant human ZNF706 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC015925 Sequence: MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA Predict reactive species\nFull Name: zinc finger protein 706\nCalculated Molecular Weight: 76 aa, 8 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC015925\nGene Symbol: ZNF706\nGene ID (NCBI): 51123\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9Y5V0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887952908457,"sku":"32274-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32274-1-ap","provider":"Iright","version":"1.0","type":"link"}