{"product_id":"proteintech-32281-1-ap","title":"Proteintech, 32281-1-AP, HLA-DQB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HLA-DQB1 (32281-1-AP) by Proteintech is a Polyclonal antibody targeting HLA-DQB1 in WB, IHC, ELISA applications with reactivity to human samples\n32281-1-AP targets HLA-DQB1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Ramos cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe HLA-DQB1 gene is part of the human leukocyte antigen (HLA) complex, which is involved in the immune system's ability to distinguish the body's own proteins from those made by foreign invaders such as viruses and bacteria. It belongs to the MHC class II genes, which provide instructions for making proteins present on the surface of certain immune system cells. These proteins attach to protein fragments (peptides) outside the cell and display them to the immune system. If the immune system recognizes the peptides as foreign, it triggers a response to attack the invading pathogens.\n.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34755 Product name: Recombinant human HLA-DQB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-230 aa of BC012106 Sequence: RDSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRAQSESAQSK Predict reactive species\nFull Name: major histocompatibility complex, class II, DQ beta 1\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC012106\nGene Symbol: HLA-DQB1\nGene ID (NCBI): 3119\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P01920\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887668777129,"sku":"32281-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32281-1-ap","provider":"Iright","version":"1.0","type":"link"}