{"product_id":"proteintech-32283-1-ap","title":"Proteintech, 32283-1-AP, WBP4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WBP4 (32283-1-AP) by Proteintech is a Polyclonal antibody targeting WBP4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n32283-1-AP targets WBP4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  Jurkat cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWW domain-binding protein 4 (WBP4), formerly known as FBP21, is a 376-amino acid spliceosomal protein containing a zinc finger motif and two tandem WW domains. It is a member of the WW domain-containing protein family, which plays a role in various cellular processes including signal transduction, transcriptional regulation and protein degradation. The protein is characterised by its WW domains, which mediate interactions with proline-rich motifs in other proteins. WBP4 is involved in key signalling pathways such as Wnt and Notch and interacts with transcription factors and components of the ubiquitin-proteasome system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35400 Product name: Recombinant human WBP4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC108310 Sequence: MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRKKDPSKGRWVEGITSEGYHYYYDLISGASQW Predict reactive species\nFull Name: WW domain binding protein 4 (formin binding protein 21)\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC108310\nGene Symbol: WBP4\nGene ID (NCBI): 11193\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O75554\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887921582249,"sku":"32283-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32283-1-ap","provider":"Iright","version":"1.0","type":"link"}