{"product_id":"proteintech-32307-1-ap","title":"Proteintech, 32307-1-AP, MOSPD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MOSPD1 (32307-1-AP) by Proteintech is a Polyclonal antibody targeting MOSPD1 in WB, IHC, ELISA applications with reactivity to human samples\n32307-1-AP targets MOSPD1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MDA-MB-231 cells, PC-3 cells\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMOSPD1, or Motile Sperm Domain-Containing Protein 1, is a protein that has been implicated in various biological processes. It is part of a family of proteins characterized by the presence of the major sperm protein domain and two transmembrane domains (PMID: 21792907). The protein is primarily located in the endoplasmic reticulum and Golgi apparatus, and it can also be found in the nucleus under certain conditions. MOSPD1 plays a significant role in the differentiation and proliferation of mesenchymal stem cells (MSCs). Studies have shown that MOSPD1-null embryonic stem cells exhibit impaired differentiation into various cell lineages, including osteoblasts and adipocytes, indicating its importance in MSC proliferation and differentiation (PMID: 26175344). Additionally, MOSPD1 is involved in the switch between mesenchymal and epithelial cells, suggesting its role in developmental regulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37532 Product name: Recombinant human MOSPD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC005700 Sequence: MHQQKRQPELVEGNLPVFVFPTELIFYADDQSTHKQVLTLYNPYEFALKFKVLCTTPNKYVVVDAAGAVKPQCCVDIVIRHRDVRSCHYGVIDKFRLQVSEQSQRKALGRKEVVATLLPSAKEQQKEEEEKRLKEHLTESLFFEQSFQPENRAVSSGPSLLTVFLGVVCIAALMLPTLGDVESLVPLYLHLSVNQKLVAAYILGLITMAILRT Predict reactive species\nFull Name: motile sperm domain containing 1\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC005700\nGene Symbol: MOSPD1\nGene ID (NCBI): 56180\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9UJG1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887722614953,"sku":"32307-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32307-1-ap","provider":"Iright","version":"1.0","type":"link"}