{"product_id":"proteintech-32331-1-ap","title":"Proteintech, 32331-1-AP, DLL4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DLL4 (32331-1-AP) by Proteintech is a Polyclonal antibody targeting DLL4 in WB, ELISA applications with reactivity to human, mouse samples\n32331-1-AP targets DLL4 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse brain tissue,  mouse kidney tissue,  mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDLL4, also named as Delta4, plays a role in the Notch signaling pathway. It activates Notch-1 and Notch-4. Notch signaling is activated upon engagement of the Notch receptor with its ligands, the DSL (Delta, Serrate, Lag2) proteins of single-pass type I membrane proteins. DLL4 is highly expressed in the vascular endothelium and is involved in angiogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34664 Product name: Recombinant human DLL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-275 aa of BC106950 Sequence: EAWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEG Predict reactive species\nFull Name: delta-like 4 (Drosophila)\nCalculated Molecular Weight: 685 aa, 75 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC106950\nGene Symbol: DLL4\nGene ID (NCBI): 54567\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NR61\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887214481577,"sku":"32331-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32331-1-ap","provider":"Iright","version":"1.0","type":"link"}