{"product_id":"proteintech-32375-1-ap","title":"Proteintech, 32375-1-AP, USP43 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP43 (32375-1-AP) by Proteintech is a Polyclonal antibody targeting USP43 in WB, ELISA applications with reactivity to human samples\n32375-1-AP targets USP43 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HaCaT cells,  Jurkat cells,  MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUSP43 belongs to the DUBs family involved in cancer development and progression.The USPs family is the most recognized group of DUBs, characterized by a wide range of structural and functional variability. The distinguishing features of USPs include the unique catalytic core, known as the histidine and cysteine boxes, as well as the presence of zinc finger domains, ubiquitin-binding domains, or ubiquitin-like domains at the N and\/or Ctermini of the catalytic domain (PMID: 16325574). It has 4 isoforms with a molecular weight of 69 kDa, 89 kDa,122 kDa, 123 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36448 Product name: Recombinant human USP43 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 900-1123 aa of BC136368 Sequence: CLAPGNSDGPNTARKLKENAGQDIKLPRKFDLPLTVMPSVEHEKPARPEGQKAMNWKESFQMGSKSSPPSPYMGFSGNSKDSRRGTSELDRPLQGTLTLLRSVFRKKENRRNERAEVSPQVPPVSLVSGGLSPAMDGQAPGSPPALRIPEGLARGLGSRLERDVWSAPSSLRLPRKASRAPRGSALGMSQRTVPGEQASYGTFQRVKYHTLSLGRKKTLPESSF Predict reactive species\nFull Name: ubiquitin specific peptidase 43\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC136368\nGene Symbol: USP43\nGene ID (NCBI): 124739\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q70EL4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887918731433,"sku":"32375-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32375-1-ap","provider":"Iright","version":"1.0","type":"link"}