{"product_id":"proteintech-32384-1-ap","title":"Proteintech, 32384-1-AP, SLC7A11\/xCT Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC7A11\/xCT (32384-1-AP) by Proteintech is a Polyclonal antibody targeting SLC7A11\/xCT in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n32384-1-AP targets SLC7A11\/xCT in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled HeLa cells, unboiled mouse brain tissue,  unboiled rat brain tissue\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC7A11 (also known as xCT) is a membrane transporter involved in cysteine uptake. It promotes glutathione synthesis through cystine uptake and the concomitant release of glutamate. This, in turn, protects cells from oxidative stress, maintains cellular redox balance, and prevents cell death induced by lipid peroxidation. SLC7A11 has been identified as a potential target for cancer therapeutics. It is overexpressed in multiple malignant tumors and is closely associated with the growth, prognosis, metastasis, and treatment response of various cancers, including lung cancer. 32384-1-AP recognizes the 35-40 kDa protein similar to the paper published (PMID: 36747082).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38215 Product name: Recombinant mouse Slc7a11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-42 aa of NM_011990 Sequence: MVRKPVVATISKGGYLQGNMSGRLPSMGDQEPPGQEKVVLKK Predict reactive species\nFull Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 11\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: NM_011990\nGene Symbol: Slc7a11\nGene ID (NCBI): 26570\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9WTR6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869384986793,"sku":"32384-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32384-1-ap","provider":"Iright","version":"1.0","type":"link"}