{"product_id":"proteintech-32462-1-ap","title":"Proteintech, 32462-1-AP, CD42c Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD42c (32462-1-AP) by Proteintech is a Polyclonal antibody targeting CD42c in WB, ELISA applications with reactivity to human samples\n32462-1-AP targets CD42c in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human peripheral blood platelets\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD42c, also known as platelet glycoprotein Ib beta chain (GP1BB), is a transmembrane protein containing a leucine-rich amino acid sequence (PMID: 3353370). CD42c is covalently linked to platelet glycoprotein Ib alpha chain (CD42b\/GP1BA) to form GPIb, which is part of the Glycoprotein Ib-V-IX receptor (GPIb-V-IX) complex that constitutes the receptor for von Willebrand factor (VWF), and mediates platelet adhesion (PMID: 7660135). Mutations in the GP1BB gene have been associated with Bernard-Soulier syndrome, velocardiofacial syndrome, and giant platelet disorder.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36521 Product name: Recombinant human GP1BB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-147 aa of NM_000407.4 Sequence: PAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLC Predict reactive species\nFull Name: glycoprotein Ib (platelet), beta polypeptide\nCalculated Molecular Weight: 22kDa，206aa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: NM_000407.4\nGene Symbol: CD42c\nGene ID (NCBI): 2812\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P13224\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886255919273,"sku":"32462-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32462-1-ap","provider":"Iright","version":"1.0","type":"link"}