{"product_id":"proteintech-32470-1-ap","title":"Proteintech, 32470-1-AP, PLXND1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLXND1 (32470-1-AP) by Proteintech is a Polyclonal antibody targeting PLXND1 in WB, ELISA applications with reactivity to human samples\n32470-1-AP targets PLXND1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: JAR cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLXND1, also known as KIAA0620. It is predicted to be located in the cell membrane. Detected at low levels in heart, placenta, lung, skeletal muscle, kidney, thymus and liver. It is a cell surface receptor for SEMA4A and for class 3 semaphorins, such as SEMA3A, SEMA3C and SEMA3E, which plays an important role in cell-cell signaling, and in regulating the migration of a wide spectrum of cell types. Regulates the migration of thymocytes in the medulla. The protein regulates endothelial cell migration. The molecular weight of PLXND1 is 212 kDa, and the target also has phosphorylation modification as well.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38374 Product name: Recombinant human PLXND1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1515-1700 aa of NM_015103.2 Sequence: FLLLCAIKQQINKGSIDAITGKARYTLSEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKKSHRQSHRKKVLP Predict reactive species\nFull Name: plexin D1\nCalculated Molecular Weight: 212kDa，1925aa\nObserved Molecular Weight: 220-250\nGenBank Accession Number: NM_015103.2\nGene Symbol: PLXND1\nGene ID (NCBI): 23129\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9Y4D7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887766655145,"sku":"32470-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32470-1-ap","provider":"Iright","version":"1.0","type":"link"}