{"product_id":"proteintech-32471-1-ap","title":"Proteintech, 32471-1-AP, JPH4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe JPH4 (32471-1-AP) by Proteintech is a Polyclonal antibody targeting JPH4 in WB, ELISA applications with reactivity to human, mouse, rat samples\n32471-1-AP targets JPH4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nJPH4 (Junctophilin 4) is a member of the junctophilin family of transmembrane proteins. JPH4 is involved in the formation of junctional membrane complexes between the plasma membrane and the endoplasmic\/sarcoplasmic reticulum in excitable cells. It plays a crucial role in maintaining the structural integrity and function of these complexes. JPH4 is biased in expression in the brain (RPKM 34.3) and endometrium (RPKM 8.7), among other tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38425 Product name: Recombinant human JPH4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 450-600 aa of NM_001146028.1 Sequence: GLTPSEGSPELPSSPASSRQPWRPPACRSPLPPGGDQGPFSSPKAWPEEWGGAGAQAEELAGYEAEDEAGMQGPGPRDGSPLLGGCSDSSGSLREEEGEDEEPLPPLRAPAGTEPEPIAMLVLRGSSSRGPDAGCLTEELGEPAATERPAQ Predict reactive species\nFull Name: junctophilin 4\nCalculated Molecular Weight: 66kDa，628aa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_001146028.1\nGene Symbol: JPH4\nGene ID (NCBI): 84502\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96JJ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887689584809,"sku":"32471-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32471-1-ap","provider":"Iright","version":"1.0","type":"link"}