{"product_id":"proteintech-32474-1-ap","title":"Proteintech, 32474-1-AP, ELOVL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ELOVL3 (32474-1-AP) by Proteintech is a Polyclonal antibody targeting ELOVL3 in WB, ELISA applications with reactivity to human, mouse samples\n32474-1-AP targets ELOVL3 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, mouse adipose tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nELOVL3 (elongation of very long-chain fatty acids 3) is a member of the ELOVL family of enzymes that synthesize very long chain fatty acids (VLCFAs). ELOVL3 is expressed primarily in brown and white adipose tissue, skin sebaceous glands, and the liver, synthesizes C20-C24 saturated and monounsaturated fatty acids (PMID: 37847682). ELOVL3 is involved in the regulation of the progression of adipogenesis through activation of peroxisome proliferator-activated receptor (PPAR)γ in mouse adipocytic 3T3-L1 cells (PMID: 22436697, 16326704).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24318 Product name: Recombinant human ELOVL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-126 aa of BC034344 Sequence: YNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIMGTVLLTGGLKQTVCFINFIDNSTVKFWSWVFLLSKVI Predict reactive species\nFull Name: elongation of very long chain fatty acids (FEN1\/Elo2, SUR4\/Elo3, yeast)-like 3\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC034344\nGene Symbol: ELOVL3\nGene ID (NCBI): 83401\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9HB03\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887516405929,"sku":"32474-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32474-1-ap","provider":"Iright","version":"1.0","type":"link"}