{"product_id":"proteintech-32517-1-ap","title":"Proteintech, 32517-1-AP, SPATS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPATS2 (32517-1-AP) by Proteintech is a Polyclonal antibody targeting SPATS2 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n32517-1-AP targets SPATS2 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  Jurkat cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPATS2, also known as SCR59 and SPATA10, is a member of the RNA-binding proteins whose aberrant expression is associated with carcinogenesis in several types of cancer.  It is mainly expressed in the adult testis, with low expression in liver and other tissues (PMID: 33037180).  The apparent molecular weight is higher than the calculated molecular weight of 60 kDa, probably due to post-translational modification, probably by phosphorylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38507 Product name: Recombinant human SPATS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 94-240 aa of NM_001293285.1 Sequence: NKPKPAAEPSNGIPDSSKSVSIQEEQSAPSSEKGGMNGYHVNGAINDTESVDSLSEGLETLSIDARELEDPESAMLDTLDRTGSMLQNGVSDFETKSLTMHSIHNSQQPRNAAKSLSRPTTETQFSNMGMEDVPLATSKKLSSNIEK Predict reactive species\nFull Name: spermatogenesis associated, serine-rich 2\nCalculated Molecular Weight: 60kDa，545aa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_001293285.1\nGene Symbol: SPATS2\nGene ID (NCBI): 65244\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q86XZ4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887814037673,"sku":"32517-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32517-1-ap","provider":"Iright","version":"1.0","type":"link"}