{"product_id":"proteintech-32522-1-ap","title":"Proteintech, 32522-1-AP, PRSS21 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRSS21 (32522-1-AP) by Proteintech is a Polyclonal antibody targeting PRSS21 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n32522-1-AP targets PRSS21 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRSS21 (Serine Protease 21), a trypsin family member, may be active on peptide linkages involving the carboxyl group of lysine or arginine.  In terms of disease association, PRSS21 is implicated in various cancers, such as gastric cancer, testicular cancer, and ovarian cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38156 Product name: Recombinant human PRSS21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-314 aa of BC074999 Sequence: MGARGALLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQSGMSQPDPSWPLLFFPLLWALPLLGPV Predict reactive species\nFull Name: protease, serine, 21 (testisin)\nCalculated Molecular Weight: 314 aa, 35 kDa\nGenBank Accession Number: BC074999\nGene Symbol: PRSS21\nGene ID (NCBI): 10942\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6M0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887775273129,"sku":"32522-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32522-1-ap","provider":"Iright","version":"1.0","type":"link"}