{"product_id":"proteintech-32542-1-ap","title":"Proteintech, 32542-1-AP, Reg2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Reg2 (32542-1-AP) by Proteintech is a Polyclonal antibody targeting Reg2 in WB, ELISA applications with reactivity to mouse samples\n32542-1-AP targets Reg2 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nReg2 protein, an important member of the Reg protein family, is mainly expressed in pancreatic islet β-cells and has the function of promoting cell proliferation and protecting cells from damage. It is involved in the regulation of pancreatic islet cell regeneration and functional maintenance, and Reg2 expression is critical for maintaining glucose homeostasis in response to high-fat diet-induced obesity and aging. In addition, Reg2 protein exhibits protective effects on pancreatic islet β-cells in diabetes models and is able to attenuate streptozotocin (STZ)-induced injury. In autoimmune responses, Reg2 may also be involved in the pathogenesis of type 1 diabetes as a target. Therefore, Reg2 protein has important potential applications in diabetes research and therapy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2693 Product name: Recombinant Mouse Reg2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-173 aa of NM_009043.1 Sequence: QVAEEDFPLAEKDLPSAKINCPEGANAYGSYCYYLIEDRLTWGEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRRWHWSSGSLFLFKSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVCKFRA Predict reactive species\nFull Name: regenerating islet-derived 2\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: NM_009043.1\nGene Symbol: Reg2\nGene ID (NCBI): 19693\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q08731\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887782056105,"sku":"32542-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32542-1-ap","provider":"Iright","version":"1.0","type":"link"}