{"product_id":"proteintech-32562-1-ap","title":"Proteintech, 32562-1-AP, FAM50B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FAM50B (32562-1-AP) by Proteintech is a Polyclonal antibody targeting FAM50B in WB, ELISA applications with reactivity to human samples\n32562-1-AP targets FAM50B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, MDA-MB-231 cells,  U-87 MG cells,  SK-BR-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFAM50B, also known as family with sequence similarity 50, member B, is a protein-coding gene located on chromosome 6. It is widely expressed in various tissues, with particularly high abundance in the testis and both adult and fetal brain. The exact function of FAM50B is not yet fully understood and is still under investigation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38226 Product name: Recombinant human FAM50B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 73-141 aa of NM_012135.2 Sequence: MKARQEALVRERERQLAKRQHLEEQRLQQERQREQEQRRERKRKISCLSFALDDLDDQADAAEARRAGN Predict reactive species\nFull Name: family with sequence similarity 50, member B\nCalculated Molecular Weight: 39kDa，325aa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: NM_012135.2\nGene Symbol: FAM50B\nGene ID (NCBI): 26240\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9Y247\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887633092777,"sku":"32562-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32562-1-ap","provider":"Iright","version":"1.0","type":"link"}