{"product_id":"proteintech-32583-1-ap","title":"Proteintech, 32583-1-AP, ZSCAN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZSCAN1 (32583-1-AP) by Proteintech is a Polyclonal antibody targeting ZSCAN1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n32583-1-AP targets ZSCAN1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue, mouse testis tissue,  MDA-MB-231 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZSCAN1 is a transcription factor containing a zinc finger domain and a SCAN domain. ZSCAN1 has been implicated in diverse biological processes. It has been shown to act as a stemness-related tumor suppressor and transcriptional repressor in breast cancer, targeting TAZ to influence cancer progression.  Additionally, ZSCAN1 is involved in early embryonic development, where it helps regulate the expression of genes necessary for proper embryogenesis. It also plays a role in the immune response, with anti-ZSCAN1 autoantibodies being identified as potential diagnostic markers for certain syndromes like ROHHAD (PMID: 38339072). According to Human Protein Atlas database, ZSCAN1 is mainly expressed in brain, pituitary gland and testis tissue.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37955 Product name: Recombinant human ZSCAN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 261-400 aa of NM_182572 Sequence: HQPSLKHTKGGTQEAVAGISVVPRGPRGGRPFQCADCGMVFTWVTHFIEHQKTHREEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQK Predict reactive species\nFull Name: zinc finger and SCAN domain containing 1\nCalculated Molecular Weight: 408 aa, 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: NM_182572\nGene Symbol: ZSCAN1\nGene ID (NCBI): 284312\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8NBB4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887954514089,"sku":"32583-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32583-1-ap","provider":"Iright","version":"1.0","type":"link"}