{"product_id":"proteintech-32584-1-ap","title":"Proteintech, 32584-1-AP, WASF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WASF1 (32584-1-AP) by Proteintech is a Polyclonal antibody targeting WASF1 in WB, IP, ELISA applications with reactivity to human samples\n32584-1-AP targets WASF1 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells\nPositive IP detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWASF1 (Wiskott-Aldrich Syndrome Protein Family Member 1) is a gene encoding an actin-binding protein that belongs to the Wiskott-Aldrich syndrome protein family. It is primarily involved in regulating the reorganization of the actin cytoskeleton in cells, and is essential for processes such as cell morphology, motility, and signaling. WASF1 promotes actin polymerization by interacting with the Arp2\/3 complex, thereby affecting cell deformation and migration. WASF1 is expressed in a variety of cell types, including tissues such as brain and testis. Its aberrant expression is associated with a variety of diseases, such as tumor invasion and metastasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38505 Product name: Recombinant human WASF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 180-320 aa of NM_003931.2 Sequence: KQKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFV Predict reactive species\nFull Name: WAS protein family, member 1\nCalculated Molecular Weight: 62kDa，559aa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: NM_003931.2\nGene Symbol: WASF1\nGene ID (NCBI): 8936\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q92558\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887921320105,"sku":"32584-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-32584-1-ap","provider":"Iright","version":"1.0","type":"link"}